PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g00710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 344aa    MW: 37485.7 Da    PI: 6.3386
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g00710.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260107.11.4e-336615214100
          DUF260  14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                     ++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lq++l+q ++el+ +k+e
  Vang07g00710.1  66 TECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELSASQRDDAVKSLAYEAEARLRDPVYGCVGLISVLQHRLRQIQVELNNAKKE 152
                     68********************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.71252153IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-3366150IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MCAVVSGRRG SWSEEGTERE PHPHPLSSHH SSFREPPHYG YDPASPAQQE KLQDAAVTIA  60
IGLTRTECVF APYFPPDNPQ RFAYVHKVFG ASNVAKLLNE LSASQRDDAV KSLAYEAEAR  120
LRDPVYGCVG LISVLQHRLR QIQVELNNAK KELATYIGPQ AFQGLPAPIL QQHPNNPFSG  180
SLYGSMAGVT AATHGGQLMI RDGQSPQQHQ ILEAQQLAAA VAAREQQEMF RGYEHQQQQE  240
FLRFSGGFDV GSASSAGGFS QISPAAASAD QLSPSLALGS FDNPYHMQQP QQGEPHPHNI  300
PFEAQLLLPP QQKQSPQQSQ QSQLPLHQPQ SESEECRSLG PSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520349.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ37e-62LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0S3T5Q40.0A0A0S3T5Q4_PHAAN; Uncharacterized protein
STRINGGLYMA11G06210.21e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-57ASYMMETRIC LEAVES 2-like 1